Protein Info for Shewana3_0830 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details PF03994: DUF350" amino acids 23 to 74 (52 residues), 23.5 bits, see alignment 2.3e-09 amino acids 92 to 147 (56 residues), 43.3 bits, see alignment E=1.5e-15 amino acids 247 to 296 (50 residues), 22.7 bits, see alignment 4.2e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to shm:Shewmr7_0861)

Predicted SEED Role

"FIG01058021: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTE9 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Shewana3_0830 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MTLFQDFGITPELVTILAIDLTIAVILLTLMRYLQGWSVRVNSSKELAERDNFAFGISTA
GAVAALGIVLTGAITGAAAPSYLTEAIGMSAYGLFGLVLIKLGRFLHDKIALNELDKNQQ
ILKGNVSVAIVDASAAIATAIIIRAVLLWAEDLTLDTFIAIFSAFAISQLMLVLLTRLRE
KRFASRNQDSSMQQALAQGHTALAIRHAGFMIAMALSFNAASHFILFNPTAYVTNIIGWL
VFSIIMLVVLTLLLFVIKKLVLARIDLADEVERQHNIGIAAVEMAISIAIALILTALMA