Protein Info for Shewana3_0817 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 183 to 211 (29 residues), see Phobius details PF04654: DUF599" amino acids 10 to 218 (209 residues), 220.6 bits, see alignment E=7.7e-70

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0817)

Predicted SEED Role

"FIG01058150: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTD6 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Shewana3_0817 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MTFSLLDISALTWFIVSWAGYTAFARRKAKDTDCIARGLHKHRIYWMLELMTRGVRVGDA
ALLANLERNIAFFASTTLFVLAGVLTLFAQVERLEAVIATIPYATPPNHSLVQVKLALLV
VIFVMAFFQFTWSMRQYGFVNVMIGAGPMDSEGANDNLKAYARQMATVQDQAAHSYNYGL
RAYYFSMAVLCWFVHPILFILASLFVVVTLYRREFKSRAVMAITAAKAHLGSEYQAREAQ
RQAK