Protein Info for Shewana3_0813 in Shewanella sp. ANA-3

Annotation: cysteine/glutathione ABC transporter membrane/ATP-binding component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details TIGR02868: thiol reductant ABC exporter, CydC subunit" amino acids 7 to 542 (536 residues), 439.5 bits, see alignment E=9.1e-136 PF00664: ABC_membrane" amino acids 55 to 289 (235 residues), 32.3 bits, see alignment E=1.3e-11 PF00005: ABC_tran" amino acids 357 to 511 (155 residues), 106.4 bits, see alignment E=3e-34

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to shn:Shewana3_0813)

Predicted SEED Role

"Transport ATP-binding protein CydC" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTD2 at UniProt or InterPro

Protein Sequence (583 amino acids)

>Shewana3_0813 cysteine/glutathione ABC transporter membrane/ATP-binding component (RefSeq) (Shewanella sp. ANA-3)
MKILLPFIRLFSHQWLMMVVGLVLTLTTLMAGIGLLSLSGWFLSATAVAGLTVIGSQSFN
FFTPAGGVRFLSIARTASRYGERLATHEATFKLLTELRVWAWRKLFPLSAKNLQGLRRAD
MLNRLVADIDTLDHLYLRLLTPMAASLLMTALLYLFLAWFDAKLALSLCLFLVVVWLLLP
LLFYRLGHEPSRNMLETKRQYRVQLLEMLQGQAELSLFGANARYRHKLDEAEQALFTSQG
AMANITALSQAMLILATGSALIMMLFLAANGVGDAVPPGPMFALMVFATMACVEMMMPIA
GAFQHLSGCVLAATRIHEITEQESDIRFNEDSTLSATSGGLQMTDIHFGYHGNQSVLQGL
SLTVQPGQKVALLGATGCGKSSLLSLITREWQAQRGQICLDGQPLTDYSEAALRSAMTVV
SQRIYLYAGTLRENLAIALPVPEGQKRTANDERFIQVLQQVGLGELLKGDKPLDMWIGEG
GRQLSGGEQRRIGVARALLRDAPLLLLDEPTEGLDKRTEREILSLLFEFAKDKTLLMISH
RLTAMAKMDQIHLLAEGQIVASGDHQQLLQTCPAYQALYRRLA