Protein Info for Shewana3_0801 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF08000: bPH_1" amino acids 2 to 122 (121 residues), 159.3 bits, see alignment E=4.1e-51 PF14470: bPH_3" amino acids 42 to 97 (56 residues), 31.5 bits, see alignment E=1.9e-11

Best Hits

Swiss-Prot: 53% identical to YJQA_BACSU: Uncharacterized protein YjqA (yjqA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 98% identity to shm:Shewmr7_0829)

Predicted SEED Role

"DUF1696 domain-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTC0 at UniProt or InterPro

Protein Sequence (124 amino acids)

>Shewana3_0801 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MGLLDGLLGNASEVNLQELAEELRPIMGIQEELKLAYKVVRDLFVFTNKRLILIDKQGLT
GQKTSYHSVPYKSITHFEVETTGHFDMDAELRIWISGQSDPLVKELKRGTDVVGIQKTIA
TFAL