Protein Info for Shewana3_0769 in Shewanella sp. ANA-3

Name: prfA
Annotation: peptide chain release factor 1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00019: peptide chain release factor 1" amino acids 1 to 359 (359 residues), 553.3 bits, see alignment E=1.1e-170 PF03462: PCRF" amino acids 14 to 205 (192 residues), 265.6 bits, see alignment E=2.8e-83 PF00472: RF-1" amino acids 215 to 323 (109 residues), 145.9 bits, see alignment E=4.9e-47

Best Hits

Swiss-Prot: 100% identical to RF1_SHESA: Peptide chain release factor 1 (prfA) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K02835, peptide chain release factor 1 (inferred from 100% identity to shm:Shewmr7_0797)

Predicted SEED Role

"Peptide chain release factor 1" in subsystem LMPTP YwlE cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KT88 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Shewana3_0769 peptide chain release factor 1 (RefSeq) (Shewanella sp. ANA-3)
MKESVIRKLEGLLERNEEVLALLGDASVIADQERFRALSKEYSQLEEVVAGFKAYQQAQA
DLESAKEMLEEDDAEMREMAQEEIKAAKAELERLEAELQILLLPKDPNDDTNAFIEIRAG
AGGDEAAIFAGDLFRMYSRYAEANRWQLEIMSSNEGEHGGFKEIIVKVSGEGAYGKLKFE
SGGHRVQRVPETESQGRVHTSAVTVVVMHEVPEAEAISINPADLKVDTFRSSGAGGQHVN
KTDSAIRITHIPTGIVVECQDQRSQHKNRAQAMSVLAARIQAVEDEKRRSAEESTRRSLV
ASGDRSERVRTYNFPQGRVSEHRINLTLYRLNEVMEGDLDAILGPLMQEHQADLLAALAD
EQG