Protein Info for Shewana3_0742 in Shewanella sp. ANA-3

Name: modB
Annotation: molybdate ABC transporter permease protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 25 to 51 (27 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 26 to 235 (210 residues), 248 bits, see alignment E=3.5e-78 PF00528: BPD_transp_1" amino acids 40 to 227 (188 residues), 64.4 bits, see alignment E=5.8e-22

Best Hits

Swiss-Prot: 71% identical to MODB_ECOLI: Molybdenum transport system permease protein ModB (modB) from Escherichia coli (strain K12)

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 99% identity to she:Shewmr4_3196)

MetaCyc: 71% identical to molybdate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KT61 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Shewana3_0742 molybdate ABC transporter permease protein (RefSeq) (Shewanella sp. ANA-3)
MLSDVLVSGSLFDGPLLSEYETAALLLSLKVSAVAVLASLPLGILCAWLLARVEFPGKAI
FDSLLHLPLVLPPVVVGYLLLISMGRQGVIGQWLYNWFGVSFSFSWRGAALAAAVVSFPL
MVRAIRQSFETVDIRLEQAARTLGSSRWRVFLTITLPLTSPGIVSGMIIAFARSLGEFGS
TITFVSNIPGETRTIPLAMYSFIETPGAEYQAMRLCIISIVIALASLLASQWLTKKALKR
TASVC