Protein Info for Shewana3_0711 in Shewanella sp. ANA-3

Annotation: response regulator receiver protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 PF13237: Fer4_10" amino acids 15 to 63 (49 residues), 28.3 bits, see alignment 6.2e-10 PF00037: Fer4" amino acids 15 to 37 (23 residues), 27.3 bits, see alignment (E = 1e-09) amino acids 46 to 68 (23 residues), 27.7 bits, see alignment (E = 7.8e-10) TIGR02512: [FeFe] hydrogenase, group A" amino acids 15 to 399 (385 residues), 499.3 bits, see alignment E=3.1e-154 PF12838: Fer4_7" amino acids 21 to 66 (46 residues), 29.6 bits, see alignment 3.5e-10 PF25160: LdpA_Fe-S-bd" amino acids 27 to 70 (44 residues), 28.2 bits, see alignment 5.7e-10 PF12837: Fer4_6" amino acids 47 to 67 (21 residues), 26.9 bits, see alignment (E = 1.6e-09) PF02906: Fe_hyd_lg_C" amino acids 87 to 395 (309 residues), 337.4 bits, see alignment E=3.2e-104

Best Hits

KEGG orthology group: K00532, ferredoxin hydrogenase [EC: 1.12.7.2] (inferred from 100% identity to shn:Shewana3_0711)

Predicted SEED Role

"Periplasmic [Fe] hydrogenase large subunit (EC 1.12.7.2)" in subsystem Hydrogenases (EC 1.12.7.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KT30 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Shewana3_0711 response regulator receiver protein (RefSeq) (Shewanella sp. ANA-3)
MTATTYQPGEIQGLIKINASKCKGCDACKQFCPTHAIHGASGAVHSIDEDKCLSCGQCLI
NCPFSAIEETHSALETVIKKLADKNTTVVGIIAPAVRVAIGEEFGLGTGELVTGKLYGAM
NQAGFKIFDCNFAADLTIMEEGSEFIHRLHANVKGEENAGALPQFTSCCPGWVRYLETRY
PALLPNLSTAKSPQQMAGTVAKTYGAKVYQMQPENIFTVSVMPCTSKKLEASRPEFNSAW
QYHQEQGANTPSYQDIDAVLTTREMAQLLKMLDIDLANTPEYQGDSMFSEYTGAGTIFGT
TGGVMEAALRTAHKVLTGTEMAKLEFEPVRGLKGVKSASVSLFDTQLNQNVTVNVAVVHD
MGNNIEPVLRDVMAGTSPYHFIEVMNCAGGCVNGGGQPIEGKGSSWLGNI