Protein Info for Shewana3_0679 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 49 to 74 (26 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 6 to 259 (254 residues), 312.7 bits, see alignment E=1.1e-97 PF02405: MlaE" amino acids 46 to 257 (212 residues), 250.3 bits, see alignment E=7.5e-79

Best Hits

Swiss-Prot: 68% identical to MLAE_HAEIN: Intermembrane phospholipid transport system permease protein MlaE (mlaE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to shn:Shewana3_0679)

Predicted SEED Role

"Uncharacterized ABC transporter, permease component YrbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSZ8 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Shewana3_0679 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MKLFDSIADLGRSAIDLVLGFGRAGLMLWGAIFRWPRVRKGFPLLVRQIYVVGVQSMVII
VVSGLFIGMVLALQGYNILVGFGTEESLGPMVALSLLRELGPVVTALLFAGRAGSALTAE
IGLMKSTEQLSSLEMMAIDPLRQIIAPRFWAGVISMPLLALMFTAVGIYGGHLVGVEWKG
IDGGAFWSILQASVEWRQDIVNCLIKSGVFAVVVTWIALYRGYQVVPNPEGISRATTSTV
VQSSLAVLALDFLLTALMFGR