Protein Info for Shewana3_0678 in Shewanella sp. ANA-3

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF00005: ABC_tran" amino acids 25 to 173 (149 residues), 112 bits, see alignment E=1.8e-36

Best Hits

Swiss-Prot: 65% identical to MLAF_ECOL6: Intermembrane phospholipid transport system ATP-binding protein MlaF (mlaF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02065, putative ABC transport system ATP-binding protein (inferred from 98% identity to she:Shewmr4_0679)

Predicted SEED Role

"Uncharacterized ABC transporter, ATP-binding protein YrbF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSZ7 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Shewana3_0678 ABC transporter related (RefSeq) (Shewanella sp. ANA-3)
MTQEQTPLVEIRHLGFSRGQRVIYEDISLSIPRGKVTAIMGPSGIGKTTLLKLIGGQLTP
DSGQVLFDGQDVHAASRSQLFELRKRMSMLFQSGALFTDINVFDNVAFALREHSGLPEEI
IRSIVLMKLEAVGLRGAAQMMPSELSGGMQRRAALARAIALEPEMVMYDEPFAGQDPISM
GVLVKLIRELSDALNLTSIVVSHDVDEVLGIADYVYVVADKRVIAHGTPEELKHADNPQL
KQFIQGAPDGPVPFHYPAKDYQQELMAKGAGK