Protein Info for Shewana3_0648 in Shewanella sp. ANA-3

Annotation: fructose-1,6-bisphosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF00316: FBPase" amino acids 8 to 181 (174 residues), 183.7 bits, see alignment E=3e-58 PF18913: FBPase_C" amino acids 187 to 318 (132 residues), 148 bits, see alignment E=1.3e-47

Best Hits

Swiss-Prot: 100% identical to F16PA_SHESA: Fructose-1,6-bisphosphatase class 1 (fbp) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 100% identity to shn:Shewana3_0648)

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSW7 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Shewana3_0648 fructose-1,6-bisphosphatase (RefSeq) (Shewanella sp. ANA-3)
MQTLAQHLTSKAVNESLSQLILTLADTSKAISHAVRHGALAGVLGATEQENVQGETQKKL
DIITNDMLKDALKADGTVRGLASEEEDHVVEVCANGQYLVCFDPLDGSSNIDINSLVGTI
FSVLPAPQGELTETSFLQSGRNQLAAGYVLYGPSTMLALTTGQGVQLFTLHPETNEFLLT
NAAMSISPDTQEFAINMSNQRFWEAPMQTYIADLLLGKIGPREKSFNMRWIAAMVGDVHR
VLSRGGIFTYPTDNKDPKKPYKLRLMYEANPMALLVEQAGGKASTGYETILDIQPTQIHQ
RVAVILGSANEVDACLSYHGLDYSEEPSLD