Protein Info for Shewana3_0642 in Shewanella sp. ANA-3

Annotation: sodium:dicarboxylate symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 218 to 218 (1 residues), see Phobius details amino acids 220 to 246 (27 residues), see Phobius details amino acids 302 to 326 (25 residues), see Phobius details amino acids 335 to 361 (27 residues), see Phobius details PF00375: SDF" amino acids 5 to 402 (398 residues), 361.6 bits, see alignment E=2.8e-112

Best Hits

KEGG orthology group: None (inferred from 99% identity to shm:Shewmr7_3378)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSW1 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Shewana3_0642 sodium:dicarboxylate symporter (RefSeq) (Shewanella sp. ANA-3)
MIKSLSTRIFIGLFAGLILGTLVQYFLNDIGFFSGNLVELAGGVGTMFVNMIMMLVVPLV
FVSIVCGVCELQDLKSFGRLGGKTFGFYIVNTLVAISTALLVVLLLDPGKGVDMSSTDGV
AITATELPSLMALLIDIVPRNPVAAFMSGNMLQVIFMALMLGGVIKSLGEHVAGAVQGFQ
TANKIMMKLISVVMSLAPYGVFALMFKLGATLDAAVFISVLEYVVIILALLLLWIFVVYP
LAVGFFTPISAKSFREKTQEQVLFSLSTASSNATIPVTMRTLTEKLGVNRAVAGFGVPLG
ATMNMGGVAIYITIAIFFVANAFGMPITSEQLPSLLFSIFLLSVGAGGVPGGGMVMIGVL
IHQMGLPIEAFAIVAALDRIIDMVLTSCNVVGDTAVLTIVDQTEKTHQVELVDSES