Protein Info for Shewana3_0639 in Shewanella sp. ANA-3

Updated annotation (from data): predicted chromosome partitioning protein (with smc-like Shewana3_0638)
Rationale: conserved cofit with smc-like (Shewana3_0638)
Original annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF21980: MksE" amino acids 17 to 180 (164 residues), 28 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to shm:Shewmr7_3381)

Predicted SEED Role

"FIG020042: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSV8 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Shewana3_0639 predicted chromosome partitioning protein (with smc-like Shewana3_0638)  (Shewanella sp. ANA-3)
MSAAMNESNQTVLVGTGAIIELLLKGEFICRTTNEDGWRALKNNSTRERVEAYLNQINRT
VASAAEGDVFFCGYLQLGESERKVISSQFKDICQALIPMVEWLVLVQEASGQDAPLSEGA
PVRLTELQSRIEDTPAFREQLAKLSQYRLFGSTSTNSDAQIKLVFKRLVELGYLVRPNVE
KQIYIATGKLDYLYEVIRFIDETEGLSLEAQAETATQRDLL