Protein Info for Shewana3_0635 in Shewanella sp. ANA-3

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13247: Fer4_11" amino acids 91 to 185 (95 residues), 101.8 bits, see alignment E=7.3e-33 PF13187: Fer4_9" amino acids 98 to 143 (46 residues), 28.8 bits, see alignment 3.5e-10 PF12797: Fer4_2" amino acids 122 to 142 (21 residues), 27.6 bits, see alignment (E = 6.4e-10) PF00037: Fer4" amino acids 123 to 144 (22 residues), 34.4 bits, see alignment (E = 4.7e-12)

Best Hits

KEGG orthology group: K08358, tetrathionate reductase subunit B (inferred from 100% identity to shn:Shewana3_0635)

Predicted SEED Role

"Tetrathionate reductase subunit B" in subsystem Tetrathionate respiration

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSV4 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Shewana3_0635 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MDKSKRQFLGKMASVSVGAALIPVVQVQAQPAQTATTSKRYGMVIDLRRCVGCQACTVAC
TFENLPPLGQFRTTVQQYEVSQQDSATPPAFLMLPRLCNHCENPPCIPICPTGATFQRPD
GIVVVNNEWCVGCGYCVQACPYDARFINHETNTADKCTFCAHRLEAGLLPACVETCVGEA
RVIGDLNDPHSHISQLLKANQADIKVLKPDANTAPRVFYIGMNSAFEDRINGQAPVRTLL
TDSGEEIHHGH