Protein Info for Shewana3_0634 in Shewanella sp. ANA-3

Annotation: polysulphide reductase, NrfD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details PF03916: NrfD" amino acids 13 to 312 (300 residues), 88.3 bits, see alignment E=3.8e-29

Best Hits

KEGG orthology group: K08359, tetrathionate reductase subunit C (inferred from 100% identity to shn:Shewana3_0634)

Predicted SEED Role

"Tetrathionate reductase subunit C" in subsystem Tetrathionate respiration

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSV3 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Shewana3_0634 polysulphide reductase, NrfD (RefSeq) (Shewanella sp. ANA-3)
MVIKEIFTPDIAITWLPWAVQYFFLMGLAYASVWVATIHLFSAKQTDARLLKLCACLMLT
AGIVAPIALLADLHQPLRAWHFYAQIRPHSWMWYGAFLLPLFSGTSLVFAWLLLRQYLPT
KASTPGESSQDWVRRIAQLIRLGDWDSDKWIKPIALIASLSACSIALYTGMETMAIKARP
LWHTYWLPPLMATSALLAACGTLALLNRVLHGYQASTQDRLLQWVRASFGLFTLCLIGWA
LFDKGSAHEAALLLDTSPSWQLAAIWVLVTLALLALVLAVRRLPSVLMLVVSLTAVHLAW
GFRWIVLIQAQTDPKYGAGTYFYQLPWGPEGLLGIAGTFGLWLALMVLVSEFIRYHPNSA
RQAL