Protein Info for Shewana3_0587 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 10 to 31 (22 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 180 to 197 (18 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details PF00892: EamA" amino acids 9 to 138 (130 residues), 59.8 bits, see alignment E=1.8e-20 amino acids 150 to 278 (129 residues), 59.2 bits, see alignment E=2.8e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0587)

Predicted SEED Role

"Permeases of the drug/metabolite transporter (DMT) superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSQ7 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Shewana3_0587 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MSQTAKPSGLIELHLAVLMFGGTALFSKLIPLSALDITFLRCVVAALVLALLIKFRGKYI
SLASKQDYLVAIGLGVIVSLHWVTYFAAMQLSSVAIGMIAFFTYPVMTVIAEPLLTGNKI
KLMDIISGVLVLIGVVLLIPEANLGNDTTLGIAVGIVSAMLFTARNLLQKRYFSQYSGPH
AMFYQTLVAAVFLMPWHQTELQTISLETWGLIILLGVVFTAAPHALFTSALRQLSAKTVG
LVSCLQPFYGAMLALVILGEALNLNTLIGGTIIVATAIFETHQSHQSQRRKKNA