Protein Info for Shewana3_0582 in Shewanella sp. ANA-3

Annotation: methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 transmembrane" amino acids 152 to 168 (17 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details PF13426: PAS_9" amino acids 17 to 106 (90 residues), 35 bits, see alignment E=3e-12 TIGR00229: PAS domain S-box protein" amino acids 23 to 111 (89 residues), 36.7 bits, see alignment E=2.1e-13 PF00989: PAS" amino acids 24 to 104 (81 residues), 24.8 bits, see alignment E=3.9e-09 PF08447: PAS_3" amino acids 31 to 114 (84 residues), 62.8 bits, see alignment E=6.1e-21 PF00015: MCPsignal" amino acids 304 to 485 (182 residues), 157.6 bits, see alignment E=5.9e-50

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to shn:Shewana3_0582)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSQ2 at UniProt or InterPro

Protein Sequence (524 amino acids)

>Shewana3_0582 methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq) (Shewanella sp. ANA-3)
MRKNLPVTQREYDYPADWILLSTTDTKSHITYANPSFCTVAGYELSGMLGLPHNMVRHPD
MPPQAFEDLWKTIRKGEPWKGIVKNRCANGDHYWVDAYVSPIVVNGQVAEFQSVRTKPSR
EQINRAEAAYAELNKNGQVKALKRTLEMPTKLALLVLVALLPMLYLALQIGVVGFVGLAI
SALALFIGGNLILGRYRTLVAKAKKIYDNPLMAHIYTGQSDDLGAIDLALQMQNSELKSV
LGRARDSCDNVSQQAKISAAKGEEIQGTSQSQLAEIEQVATAMQQMTATLGDMSSNCADA
ASASQMASLQTINGDKTVVSTIQSIQAMAQQLQETSQVITELEGHSRDIGRVLDVIQGIA
EQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAQRTHDATKEIHTMINLLQQGTHKAV
RSMQEGVDAAGECITTADLAGAALRTIREAITTITDMTHHIASAVEEQSSVANEMNRSVV
NVSQFTHSSHQLGCEMVSLNDEVIGEMNSHTVLVGQFLKRSFKV