Protein Info for Shewana3_0542 in Shewanella sp. ANA-3

Annotation: multi-sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 719 transmembrane" amino acids 19 to 44 (26 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details PF03924: CHASE" amino acids 90 to 275 (186 residues), 212.5 bits, see alignment E=1.7e-66 TIGR00229: PAS domain S-box protein" amino acids 358 to 482 (125 residues), 84.8 bits, see alignment E=2.8e-28 PF13188: PAS_8" amino acids 361 to 410 (50 residues), 35.1 bits, see alignment 3.1e-12 PF00989: PAS" amino acids 361 to 471 (111 residues), 56.5 bits, see alignment E=9.3e-19 PF08448: PAS_4" amino acids 367 to 463 (97 residues), 32.8 bits, see alignment E=2.5e-11 PF13426: PAS_9" amino acids 371 to 475 (105 residues), 40.5 bits, see alignment E=9.8e-14 PF00512: HisKA" amino acids 497 to 562 (66 residues), 38.7 bits, see alignment E=3e-13 PF02518: HATPase_c" amino acids 606 to 712 (107 residues), 83.6 bits, see alignment E=5e-27

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to shn:Shewana3_0542)

Predicted SEED Role

"Sensory box histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSL3 at UniProt or InterPro

Protein Sequence (719 amino acids)

>Shewana3_0542 multi-sensor signal transduction histidine kinase (RefSeq) (Shewanella sp. ANA-3)
MDKDSFPDSFNFNSSKSFYASVISSSWLMLLAAVFFMGLSWYVLEEYLRDRGDERFNNNV
QDLIGAVSSRMTAYEQVLRGGVGLFLASDGVSRREWQLYVSNARLSEYYPGIQGLGFAQL
LTPATVEAFTQEVQEEGFDDYRVTPVGDRDLYCAIKYLEPFDWRNQRAFGFDMCSESTRR
AAILHAIATGLPTASGKVTLVQETPDDAQAGILMYVPLYRGQPMTEEERKQQAIGVVYAP
FRMNDLMQGIMGKRFSGLKLAIYDGMEANNESLMFSSHKALPSTNDVFYQSQLETMEGQV
WRLEVSSESRFISSAEQTQSVWLQVIGSAFILALFYSVLTMARNRYQESRLTAELIANEK
RFRLVIEASPSALFMVDRKGIITLVNTHAERLFGYARDELLGRSINMLLPEGLREIHQQH
MGSYLAQPIAKNMSLRDDLFGCCKDGTRLAIEVGLTPIHFSNGVSILATINNVSERKRIE
AQRIEHTAELERINKELDQFAYIASHDLKSPLRGIEQLTSWLSEDLSENMDENVQKYLGL
IQSRIQRMVLLLDGLLMFSRIGRVDAEIVDVDSRQLIEDMFALVAPPQGFSLELEGNFPQ
FKTVKTLLELVIRNLFSNAIKHHDQAEGVIKVVCSASNTHYWFSVIDDGPGISTKYHGKV
FEMFQTLRPRDEVEGSGLGLSLVKKTVESLGGKIQLESEGRGCCFRFSWPMRIVNKEGI