Protein Info for Shewana3_0520 in Shewanella sp. ANA-3
Name: mscL
Annotation: large-conductance mechanosensitive channel (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to MSCL_SHESA: Large-conductance mechanosensitive channel (mscL) from Shewanella sp. (strain ANA-3)
KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 99% identity to she:Shewmr4_0521)MetaCyc: 64% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86
Predicted SEED Role
"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KSJ1 at UniProt or InterPro
Protein Sequence (136 amino acids)
>Shewana3_0520 large-conductance mechanosensitive channel (RefSeq) (Shewanella sp. ANA-3) MSLIKEFKAFASRGNVIDMAVGIIIGAAFGKIVSSFVADIIMPPIGIILGGVNFSDLSIV LQAAQGDAPAVVIAYGKFIQTIIDFTIIAFAIFMGLKAINSLKRKQEEAPKAPPAPTKDQ ELLSEIRDLLKAQQEK