Protein Info for Shewana3_0447 in Shewanella sp. ANA-3

Annotation: response regulator receiver protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 330 to 347 (18 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details amino acids 427 to 445 (19 residues), see Phobius details amino acids 452 to 476 (25 residues), see Phobius details amino acids 485 to 506 (22 residues), see Phobius details PF03929: PepSY_TM" amino acids 13 to 376 (364 residues), 191.5 bits, see alignment E=1.6e-60

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0447)

Predicted SEED Role

"putative iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSC1 at UniProt or InterPro

Protein Sequence (539 amino acids)

>Shewana3_0447 response regulator receiver protein (RefSeq) (Shewanella sp. ANA-3)
MKVRSDVLRVYQSIHIWTGIIAGIVLFIGFYAGSLTMFKGAIDAWSMPPSVTLPQVSSDR
LDELVSQVLAQDDKAKNGFSLHLNDEHQSPMTWYQQGSERELSMSNQLWHASLDEQGQLV
TQLSTPSELAELIDQLHRTAGIAGEVGHDQAGVYVLGVAAFLYFLALVSGVIFLLPTLTK
SFFALRKDKGESRFWLDAHNLVGITSLPFHLVISLSVIVFAFHDQLYDGLKHMVYGEKPL
FAQPAPDRTPYTLADLPKITTVLAKVQELAPEYQVHEMTFMNLNNPRATLRLGLYNPDGF
MRGPVTDYLYMHPYSLKVSNSTIDASENGIWARSVAVFFGLHFGSYGGDLGRWVYFFLGL
SGAFLFYSGNLLWLEKRRKKQASDQTRASRLMASATVGICLGSVAALAVSMLLGKWFYAH
VSNINHLYLWLYYLVFAALVAYAFWRGAARAALLILPLCALATLAMPITSVIGVLVPSLG
VWAPHSVATLGVDLVAFGFSCVFYYGYRLTRQRVFNGPQDSVWAIPSVEPVAELRQQTS