Protein Info for Shewana3_0440 in Shewanella sp. ANA-3

Annotation: phosphoribosylamine--glycine ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00877: phosphoribosylamine--glycine ligase
  • amino acids 1 to 426 (426 residues), 579.6 bits, E=1.9e-178
• PF02844: GARS_N
  • amino acids 1 to 102 (102 residues), 137 bits, E=8.9e-44
• PF01071: GARS_A
  • amino acids 103 to 300 (198 residues), 255.9 bits, E=6.8e-80
• PF08443: RimK
  • amino acids 105 to 229 (125 residues), 22.5 bits, E=1.9e-08
• PF02786: CPSase_L_D2
  • amino acids 109 to 211 (103 residues), 28.2 bits, E=3.3e-10
• PF02843: GARS_C
  • amino acids 335 to 424 (90 residues), 113.9 bits, E=8.5e-37

Best Hits

Swiss-Prot: 73% identical to PUR2_VIBCH: Phosphoribosylamine--glycine ligase (purD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 100% identity to shn:Shewana3_0440)

MetaCyc: 72% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

See A0KSB4 at UniProt or InterPro

Protein Sequence (432 amino acids)

>Shewana3_0440 phosphoribosylamine--glycine ligase (RefSeq) (Shewanella sp. ANA-3)
MKVLVIGGGGREHALAWKAAQSPQVELVYVAPGNAGTALEPKLENLNISATDIPALLDFA
QTNQIELTIVGPEAPLVLGVVDAFNAAGLPIFGPTKAAAQLEGSKAFTKDFLARHNIPTA
GYKNCTEIQDAKAFVRELTGKTGYPVVIKADGLAAGKGVIIAQDQAEADAAIEDMLAGNK
FGDAGSRVVIEEFLKGEEASFIVMVDGKNILAMATSQDHKARDNADHGPNTGGMGAYSPA
PVVTQSVHDWTIANVIRPTVDGMAAEGNVYTGFLYAGLMIAPDGSAKVLEYNCRFGDPET
QPIMMRLKSDLVELCLAATRGELDKVTAEYDSRAAVGVVLAAGGYPDDYRKGDVIQGLSL
GNHDAKVFHAGTEMKDGHVVTNGGRVLCATALGHTVTEAQKAAYLLVDEIHWDDVYFRTD
IGYRAIAREQQG