Protein Info for Shewana3_0423 in Shewanella sp. ANA-3

Annotation: N-acetyl-anhydromuranmyl-L-alanine amidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF01510: Amidase_2" amino acids 26 to 167 (142 residues), 119.6 bits, see alignment E=6e-39

Best Hits

Swiss-Prot: 64% identical to AMPD_CITFR: 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (ampD) from Citrobacter freundii

KEGG orthology group: K03806, AmpD protein (inferred from 100% identity to shn:Shewana3_0423)

MetaCyc: 62% identical to N-acetylmuramoyl-L-alanine amidase (Pseudomonas aeruginosa PAO1)
N-acetylmuramoyl-L-alanine amidase. [EC: 3.5.1.28]

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) AmpD" (EC 3.5.1.28)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KS97 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Shewana3_0423 N-acetyl-anhydromuranmyl-L-alanine amidase (RefSeq) (Shewanella sp. ANA-3)
MSFEFGWYRAARRCESPHFNRRPFGEISLLVIHNISLPAGCFGLPYIDQLFQGCLDTSAD
ESFADLAGLEVSAHFLIRRDGECVQYVSCEDRAWHAGVSRYGERENCNDFSIGIELEGTD
TEPYTAAQYQQLTALTQALLAQYPALTAERIVGHCDIAPMRKTDPGPSFDWQRYLAALRD
F