Protein Info for Shewana3_0400 in Shewanella sp. ANA-3

Name: prmA
Annotation: ribosomal protein L11 methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF06325: PrmA" amino acids 2 to 293 (292 residues), 374.6 bits, see alignment E=1.4e-115 TIGR00406: ribosomal protein L11 methyltransferase" amino acids 3 to 285 (283 residues), 346.9 bits, see alignment E=4.8e-108 PF05175: MTS" amino acids 143 to 230 (88 residues), 43.6 bits, see alignment E=8.8e-15 PF13489: Methyltransf_23" amino acids 156 to 262 (107 residues), 30.6 bits, see alignment E=9e-11 PF13847: Methyltransf_31" amino acids 158 to 230 (73 residues), 33.9 bits, see alignment E=9.2e-12 PF13649: Methyltransf_25" amino acids 162 to 208 (47 residues), 31 bits, see alignment 1.1e-10 PF08241: Methyltransf_11" amino acids 164 to 211 (48 residues), 27.1 bits, see alignment 1.9e-09

Best Hits

Swiss-Prot: 100% identical to PRMA_SHESM: Ribosomal protein L11 methyltransferase (prmA) from Shewanella sp. (strain MR-4)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to shn:Shewana3_0400)

MetaCyc: 66% identical to ribosomal protein L11 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-5419

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KS74 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Shewana3_0400 ribosomal protein L11 methyltransferase (RefSeq) (Shewanella sp. ANA-3)
MPWIQLRINTNSDDAETISDLLMEEGAVSITFEDGKDTPIFEPKLGETPLWQDTVVVALF
EADTDLAPTIEMLKTLPFLGEHFSHKIEQIEDKDWVREWMDNYHPIQFGKRLWICPSWRE
VPDPSAVNVILDPGLAFGTGTHPTTALCLEWLDSLDLSNEEVIDFGCGSGILAVAALKLG
AKKVTGIDIDYQAIEASKANAERNDVADQLALYLPEDQPADLKADVLVANILAGPLRELA
PLIAERVKSGGKLALSGLLKEQAQEISDFYSQWFDMDEAAHKEDWSRLTGKRK