Protein Info for Shewana3_0399 in Shewanella sp. ANA-3

Annotation: nifR3 family TIM-barrel protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 TIGR00737: putative TIM-barrel protein, nifR3 family" amino acids 3 to 317 (315 residues), 436.3 bits, see alignment E=3.4e-135 PF01207: Dus" amino acids 14 to 313 (300 residues), 365.9 bits, see alignment E=1.7e-113

Best Hits

Swiss-Prot: 98% identical to DUSB_SHEON: tRNA-dihydrouridine synthase B (dusB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K05540, tRNA-dihydrouridine synthase B [EC: 1.-.-.-] (inferred from 100% identity to shm:Shewmr7_3625)

MetaCyc: 65% identical to tRNA-dihydrouridine synthase B (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"tRNA dihydrouridine synthase B (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KS73 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Shewana3_0399 nifR3 family TIM-barrel protein (RefSeq) (Shewanella sp. ANA-3)
MQIGPYQLKNQLIVAPMAGVTDQAFRNLCLRYGAALAVSEMLSSNPEVWDTDKSRQRMTH
SGEEGIRSVQIAGADPELMAQAAQFNVEQGAHIIDINMGCPAKKVNKKLAGSALMQNPPL
VKEILQAVVAAVEVPVTLKIRTGWEPEHRNGVQIAQIAEDCGIASLAVHGRTRQCMYRGD
AEYDTIKAIKQNVSIPVVANGDIDSPEKARFVLDYTGVDALMIGRGAQGRPWIFREIQHY
LDTGNKLAPIEVAEQRQVMLEHLTKLYDLYGEYKGIRFARKHIGWYLDQEDQRQFRADFN
QLETAAEQYSLVEYYFDELVQN