Protein Info for Shewana3_0395 in Shewanella sp. ANA-3

Annotation: HupE/UreJ protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 53 (18 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 111 to 128 (18 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details PF04955: HupE_UreJ" amino acids 12 to 187 (176 residues), 197.3 bits, see alignment E=8.1e-63

Best Hits

KEGG orthology group: K03192, urease accessory protein (inferred from 98% identity to shm:Shewmr7_3629)

Predicted SEED Role

"Nickel-binding accessory protein UreJ-HupE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KS69 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Shewana3_0395 HupE/UreJ protein (RefSeq) (Shewanella sp. ANA-3)
MVRLSLLLLLSLSFIAPASAHEIHSGGGFMAGFNHPVLGFDHLLAMLSVGMLSTQLGGRA
IWTVPLAFVCFMLVGGILGLYAIPVPFVEIGIALSVLLLGLAIAFDRQLPLLFAMAFVGV
FAIFHGHAHGMEMPELASPILYAFGFLFGTAVIHLGGVMLGLGMQRLTGQRRLMRVSGVA
IAAMGGYLLAGF