Protein Info for Shewana3_0357 in Shewanella sp. ANA-3

Name: ilvM
Annotation: acetolactate synthase 2 regulatory subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 41% identical to ILVM_ECOLI: Acetolactate synthase isozyme 2 small subunit (ilvM) from Escherichia coli (strain K12)

KEGG orthology group: K11258, acetolactate synthase II small subunit [EC: 2.2.1.6] (inferred from 100% identity to shm:Shewmr7_3663)

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

superpathway of branched chain amino acid biosynthesis (17/17 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
superpathway of L-threonine metabolism (15/18 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
L-valine biosynthesis (4/4 steps found)
pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
pyruvate fermentation to (R)-acetoin I (2/3 steps found)
pyruvate fermentation to (S)-acetoin (2/3 steps found)
L-isoleucine biosynthesis IV (4/6 steps found)
pyruvate fermentation to (R)-acetoin II (1/2 steps found)
superpathway of (R,R)-butanediol biosynthesis (3/5 steps found)
L-isoleucine biosynthesis II (5/8 steps found)
L-isoleucine biosynthesis III (4/7 steps found)
superpathway of 2,3-butanediol biosynthesis (2/6 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KS31 at UniProt or InterPro

Protein Sequence (86 amino acids)

>Shewana3_0357 acetolactate synthase 2 regulatory subunit (RefSeq) (Shewanella sp. ANA-3)
MIHSLELTVQQRPEVIERVLRVTRHRGFTVTQMQMRMNDDASLSLDMEVDSERAIELLSN
QLNKLIDVTQCKVLLPLNLQQQKVHA