Protein Info for Shewana3_0356 in Shewanella sp. ANA-3

Annotation: acetolactate synthase 2 catalytic subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 TIGR00118: acetolactate synthase, large subunit, biosynthetic type" amino acids 8 to 552 (545 residues), 691.7 bits, see alignment E=3.4e-212 PF02776: TPP_enzyme_N" amino acids 8 to 122 (115 residues), 138.4 bits, see alignment E=1.5e-44 PF00205: TPP_enzyme_M" amino acids 192 to 327 (136 residues), 147.6 bits, see alignment E=2.8e-47 PF02775: TPP_enzyme_C" amino acids 380 to 528 (149 residues), 183 bits, see alignment E=4.6e-58

Best Hits

Swiss-Prot: 65% identical to ILVG_ECOLI: Acetolactate synthase isozyme 2 large subunit (ilvG) from Escherichia coli (strain K12)

KEGG orthology group: K01652, acetolactate synthase I/II/III large subunit [EC: 2.2.1.6] (inferred from 100% identity to shn:Shewana3_0356)

Predicted SEED Role

"Acetolactate synthase large subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KS30 at UniProt or InterPro

Protein Sequence (557 amino acids)

>Shewana3_0356 acetolactate synthase 2 catalytic subunit (RefSeq) (Shewanella sp. ANA-3)
MEPGQMIRGADAVIKVLAAHGVTTVFGYPGGAIMPIYDALYGSPVEHLLSRHEQGAAFAA
VGYARASGKTGVCFATSGPGATNLITSLADALLDSVPVVAITGQVSTAVIGTDAFQEIDV
LGMSLSCTKHSFMVTDVNDLIPTLYQAFEIAASGRPGPVLVDIPKDIQIAQLEYRTPLLA
VTNEPQASASEIDAARALLAEAKQPMLYVGGGVGMAGAVDQLREFIKATGMPSVATLKGL
GSIAHGTPGYLGMLGMHGGKAANLAVQDCDLLVVAGARFDDRVTGRLATFANKAKVIHLD
IDAAELGKLRQPDVAIAGDLRQIFPALAMALNITPWQAEVEHLARKHQWDYQHPGSLIYA
PAMLRRLANKLPEDSVVCCDVGQHQMWVAQHMWFRRPEDHLSSAGLGTMGFGLPAAIGAQ
VARPDATVVTVSGDGSFMMNVQELTTIKRRKLPVKILLIDNQKLGMVKQWQQLFFEERYS
ETDLSDNPDFVQLASAFDIPGRTIFSSDEVEEALTEMLAAKGPYLLHVAIDDAFNVWPLV
PPGASNSDMMDEMEKQT