Protein Info for Shewana3_0350 in Shewanella sp. ANA-3

Annotation: diguanylate cyclase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 142 to 168 (27 residues), see Phobius details PF01590: GAF" amino acids 275 to 409 (135 residues), 29.5 bits, see alignment E=1.5e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 437 to 603 (167 residues), 119.7 bits, see alignment E=5.4e-39 PF00990: GGDEF" amino acids 440 to 599 (160 residues), 138.9 bits, see alignment E=2e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0350)

Predicted SEED Role

"Phytochrome-like protein; Cph2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KS24 at UniProt or InterPro

Protein Sequence (605 amino acids)

>Shewana3_0350 diguanylate cyclase (RefSeq) (Shewanella sp. ANA-3)
MKHRNHSISHRMTLTIIGVSSFFAVLTMLVQLVWNYQESIDKATADIREYSESILPSIAK
SLWDVDHSLLSDLLSGLGMMPMVSSVNLESVDGVTMQLGKSLGAQEDNQTSFHYPIMYQE
QRIGSLTVGLDTNKLYYELWQQLIIIVLGNGLKTLLMIYLILTMVRLLVTNRLSALERFA
NQINLNSLPKLKVPISVVTSQDEIGHVAQSLQAMYQRIRNDLAINKRQGRELQQQQNQLA
RLVDERTQELNWQSQANQLLAEMSLQFLTTDTSQLDECLADACHRIGLLFDVERVSIIEF
TQRYANYRSFWSCESQANQIQDISVDSVAVLAQKFVSESTLVIESIDFLERESPTEYQAL
RSVGICSIAAFAIKNANELLGLLSLSMVSRPLNWNPQKKVMLTQFAAALNELLLREEKER
QMLSLQQALVSVNAQLRVMAETDELTGLSNRRPFTHTLETLLQQAKPVGLLMLDVDYFKS
YNDTYGHLEGDAALRLVAQALKQCDVLPQDSLLARIGGEEFAIILEQITPIQLEAIANQL
CYRVAALDIPHRSSPKGKITLSIGGVYLPLDTSVRGFTLSEVLRRADICLYRAKEQGRNT
VVIES