Protein Info for Shewana3_0293 in Shewanella sp. ANA-3

Annotation: anaerobic C4-dicarboxylate transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details amino acids 89 to 113 (25 residues), see Phobius details amino acids 133 to 160 (28 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 346 to 369 (24 residues), see Phobius details amino acids 381 to 399 (19 residues), see Phobius details amino acids 419 to 443 (25 residues), see Phobius details PF03605: DcuA_DcuB" amino acids 5 to 379 (375 residues), 494.2 bits, see alignment E=1.1e-152 TIGR00770: transporter, anaerobic C4-dicarboxylate uptake (Dcu) family" amino acids 5 to 446 (442 residues), 516 bits, see alignment E=4.5e-159

Best Hits

Swiss-Prot: 54% identical to DCUB_SHIFL: Anaerobic C4-dicarboxylate transporter DcuB (dcuB) from Shigella flexneri

KEGG orthology group: K07792, anaerobic C4-dicarboxylate transporter DcuB (inferred from 99% identity to shm:Shewmr7_3726)

MetaCyc: 54% identical to anaerobic C4-dicarboxylate transporter DcuB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-106; TRANS-RXN-106A; TRANS-RXN-106B; TRANS-RXN-299; TRANS-RXN0-499

Predicted SEED Role

"anaerobic C4-dicarboxylate membrane transporter"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRW7 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Shewana3_0293 anaerobic C4-dicarboxylate transporter (RefSeq) (Shewanella sp. ANA-3)
MILMEFIVVLGCLLLGTRYGGMGLGLISGIGLFLLTFVFGLAPGQPPVQVMLTILAVIGC
ASVLQTAGGLNVMMQFAERLLRRHPQYITILAPLTTWTLTFLCGTGHVVYTMFPIISDIA
LKKNIRPERPMAVASVASQMAICASPVSVAVVSMVSILAAQHGVGHAYSMLEILMVSVPA
SLCGVLVAALWSLRRGKDLDKDEEFQARIKDPEQRAFIYDKSETLLEQTFPKEAYWATGI
FFTAIAAVVLLGSFSELRPVFEVKGKLAPLSMNLVIQMMMLIAGAFILMSCKVKPTEIAN
GPVFKAGMVAIFSVFGVAWMSDTYFISHMDVLKENLSHVVQNQPWTYALVLFLISKLVNS
QAAALTAIAPMGLALGVDPKLLIAFLPASYGYFVLPTYPSDLACIGFDRTGTTKIGKFII
NHSFIIPGLIGVGTASTVGYLLATTLL