Protein Info for Shewana3_0285 in Shewanella sp. ANA-3
Annotation: hypothetical protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to PMP3_CANAX: Plasma membrane proteolipid 3 homolog (PMP3) from Candida albicans
KEGG orthology group: None (inferred from 98% identity to spc:Sputcn32_0400)Predicted SEED Role
"Plasma membrane protein involved in salt tolerance"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KRV9 at UniProt or InterPro
Protein Sequence (55 amino acids)
>Shewana3_0285 hypothetical protein (RefSeq) (Shewanella sp. ANA-3) MDTNKLLLVIIAILLPPVAVFLKAGAGKDLLINIVLCLFFWLPGLLHALWVVTKD