Protein Info for Shewana3_0250 in Shewanella sp. ANA-3

Annotation: aldehyde dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 27 to 493 (467 residues), 546.2 bits, E=2.7e-168

Best Hits

Swiss-Prot: 69% identical to ALDH_VIBC3: Aldehyde dehydrogenase (aldA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K00128, aldehyde dehydrogenase (NAD+) [EC: 1.2.1.3] (inferred from 100% identity to shn:Shewana3_0250)

MetaCyc: 74% identical to phenylacetaldehyde dehydrogenase (Pseudomonas putida U)
Phenylacetaldehyde dehydrogenase. [EC: 1.2.1.39]

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• superpathway of ornithine degradation (6/8 steps found)
• phytol degradation (3/4 steps found)
• superpathway of glycol metabolism and degradation (5/7 steps found)
• L-phenylalanine degradation II (anaerobic) (2/3 steps found)
• ethanol degradation III (2/3 steps found)
• hypotaurine degradation (2/3 steps found)
• putrescine degradation IV (2/3 steps found)
• ethylene glycol degradation (1/2 steps found)
• phenylethanol degradation (1/2 steps found)
• phenylethylamine degradation I (1/2 steps found)
• phenylethylamine degradation II (1/2 steps found)
• putrescine degradation I (1/2 steps found)
• putrescine degradation V (1/2 steps found)
• mitochondrial NADPH production (yeast) (3/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (5/8 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• histamine degradation (1/3 steps found)
• styrene degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• superpathway of L-arginine and L-ornithine degradation (8/13 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
• octane oxidation (2/5 steps found)
• D-arabinose degradation II (1/4 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (1/4 steps found)
• putrescine degradation III (1/4 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (6/11 steps found)
• serotonin degradation (3/7 steps found)
• dopamine degradation (1/5 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
• limonene degradation IV (anaerobic) (1/7 steps found)
• aromatic biogenic amine degradation (bacteria) (1/8 steps found)
• superpathway of phenylethylamine degradation (3/11 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (2/27 steps found)
• superpathway of pentose and pentitol degradation (10/42 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine degradation
• Phenylalanine metabolism
• Propanoate metabolism
• Pyruvate metabolism
• Styrene degradation
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.3 or 1.2.1.39

Sequence Analysis Tools

See A0KRS4 at UniProt or InterPro

Protein Sequence (506 amino acids)

>Shewana3_0250 aldehyde dehydrogenase (RefSeq) (Shewanella sp. ANA-3)
MIYAQPGTAGAIVNFKEKYANFIGGKWVAPVNGDYFENRSPVNGQNFCKIPRSDYRDIEL
ALDAAHAAKDAWGKTSVTERANLLLRIADRVEQNLEYLAVAETWENGKAVRETLNADLPL
FVDHFRYFAGCIRAQEGSAADIDGNTVSYHFPEPLGVVGQIIPWNFPLLMAAWKIAPALA
AGNCVVLKPAEQTPVSILVLLELIEDLLPPGILNVVNGFGAEAGQALATSKRIAKLAFTG
STEVGYHILKCAAESLIPSTVELGGKSPNLYFADVMDHEDEYLDKAVEGMLLAFFNQGEV
CTCPSRVLIQESIYDRFIEKVLARAQTIKQGNPLDTATQVGAQASQEQFDKILSYLAIGK
DEGAQVLLGGSLCQLEGDQSKGYYISPTIMKGHNKMRIFQEEIFGPVISVTTFKDEAEAL
AIANDTEYGLGAGVWTRDMNRAQRLGRGIQAGRVWINCYHAYPAHAAFGGYKKSGIGRET
HKMMLNHYQNTKNLLVSYDINPLGFF