Protein Info for Shewana3_0229 in Shewanella sp. ANA-3

Annotation: heme exporter protein CcmC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 56 to 84 (29 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 8 to 184 (177 residues), 142.7 bits, see alignment E=6.5e-46 TIGR01191: heme exporter protein CcmC" amino acids 45 to 228 (184 residues), 256 bits, see alignment E=1.1e-80

Best Hits

Swiss-Prot: 55% identical to CCMC_HAEIN: Heme exporter protein C (ccmC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02195, heme exporter protein C (inferred from 99% identity to she:Shewmr4_0229)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRQ4 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Shewana3_0229 heme exporter protein CcmC (RefSeq) (Shewanella sp. ANA-3)
MWKWLHPYADPERAYKLSGTLFPWFATLACLFIAVGTVWGLMFAPTDYQQGDSYRIIFIH
VPAASMSMAAYMGMATAAFIGLVWQIKLADWAAASIAPIGAVITFIALFTGATWGKPMWG
TWWVWDARLTSELVLLFLYLGVISLYASFEDKVLAARAAGILAIVGVINIPIIKYSVEWW
SSLHQPSTIKITSKSTMSSEMLYPLLINILGFGLMIGAITIVRFRAEILARNGMRPWVRE
LAKAEEVK