Protein Info for Shewana3_0227 in Shewanella sp. ANA-3

Annotation: cytochrome c-type biogenesis protein CcmE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to CCME_SHESA: Cytochrome c-type biogenesis protein CcmE (ccmE) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K02197, cytochrome c-type biogenesis protein CcmE (inferred from 100% identity to shn:Shewana3_0227)

MetaCyc: 57% identical to periplasmic heme chaperone (Escherichia coli K-12 substr. MG1655)
RXN-21407

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmE, heme chaperone" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

cytochrome c biogenesis (system I type) (8/11 steps found)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRQ2 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Shewana3_0227 cytochrome c-type biogenesis protein CcmE (RefSeq) (Shewanella sp. ANA-3)
MNPRRKKRLTLAVALIGGVAAIASLLLYALNSNLNLFYTPSEIVHGKTDTGVKPEAGQRI
RVGGMVTVGSMVRDPNSLHVQFAVHDSLGGEILVTYDDLLPDLFREGQGIVAQGVLGEDG
KLAATEVLAKHDENYMPPEVAEAMGQKHEKLDYSQQKSAAQ