Protein Info for Shewana3_0186 in Shewanella sp. ANA-3
Name: secE
Annotation: preprotein translocase subunit SecE (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to SECE_ECOL6: Protein translocase subunit SecE (secE) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: K03073, preprotein translocase subunit SecE (inferred from 100% identity to shn:Shewana3_0186)MetaCyc: 49% identical to Sec translocon subunit SecE (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Preprotein translocase subunit SecE (TC 3.A.5.1.1)" (TC 3.A.5.1.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KRL1 at UniProt or InterPro
Protein Sequence (123 amino acids)
>Shewana3_0186 preprotein translocase subunit SecE (RefSeq) (Shewanella sp. ANA-3) MTTNTENQTNSLDIVKWGLAILLLAAAVIGNQMYSETSAVIRALAVIVAFAIAGFIALQT EKGKKALAFARESQIEVRKVVWPTRQEALNTTFIVLAATGILALVLWGLDAVLMHIVNFI TGV