Protein Info for Shewana3_0177 in Shewanella sp. ANA-3

Annotation: Delta-9 acyl-phospholipid desaturase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details PF00487: FA_desaturase" amino acids 46 to 267 (222 residues), 80.4 bits, see alignment E=9.3e-27

Best Hits

KEGG orthology group: K00507, stearoyl-CoA desaturase (delta-9 desaturase) [EC: 1.14.19.1] (inferred from 100% identity to shn:Shewana3_0177)

Predicted SEED Role

"Fatty acid desaturase (EC 1.14.19.1); Delta-9 fatty acid desaturase (EC 1.14.19.1)" (EC 1.14.19.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.19.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRK2 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Shewana3_0177 Delta-9 acyl-phospholipid desaturase (RefSeq) (Shewanella sp. ANA-3)
MRILETIMNKPPIIWLNVILFSLTFLSAVILVPWYGLTHGYGASEWIAFVVLAFASGLSI
TAGYHRLWSHKAYKAHPAVRFLYALGGALALQNSALHWASDHRVHHKHVDDNDKDPYSAN
MGFWYSHIGWMLREYQAQRYHDYQNVRDLQNDRIVMWQHKHYLALVILMNIGLPALLGWF
TGNIAGMLLMAGLLRLVVVHHCTFFINSLAHVWGSQPYTDKNTARDNGFLAMLTYGEGYH
NFHHIFENDYRNGIKWWHYDPTKWLIKGLSWVGLAKDLRTSPQERIESARLQMQLLHAKN
KVVHLPNADEVIEKIQQEYELMKEHLLEYYQAKKALLDAKRKQLVDQQLLLQVEELKTRF
LTQQKSWKSLTASYS