Protein Info for Shewana3_0176 in Shewanella sp. ANA-3

Annotation: selenophosphate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR00476: selenide, water dikinase" amino acids 13 to 319 (307 residues), 452.8 bits, see alignment E=2.9e-140 PF00586: AIRS" amino acids 56 to 162 (107 residues), 86.3 bits, see alignment E=2e-28 PF02769: AIRS_C" amino acids 175 to 337 (163 residues), 64.8 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 100% identical to SELD_SHESA: Selenide, water dikinase (selD) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K01008, selenide, water dikinase [EC: 2.7.9.3] (inferred from 100% identity to shn:Shewana3_0176)

MetaCyc: 62% identical to selenide, water dikinase (Escherichia coli K-12 substr. MG1655)
Selenide, water dikinase. [EC: 2.7.9.3]

Predicted SEED Role

"Selenide,water dikinase (EC 2.7.9.3)" in subsystem Selenocysteine metabolism (EC 2.7.9.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.9.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRK1 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Shewana3_0176 selenophosphate synthase (RefSeq) (Shewanella sp. ANA-3)
MSNSAVSSADSIKLTEYSHGAGCGCKISPKVLTTILASQLPVFTDPNLLVGNQSRDDAAV
YKLNDEIGIISTTDFFMPIVDDPFTFGRIAATNAISDIYAMGGTPMMAIAILGWPVNKLP
AEIAQQVVDGGRQACMEAGIMLAGGHSIDAPEPIFGLAVTGQIALTDLKQNDTAKADDRL
YLTKPIGIGILTTAQKQKKLKDEDSQIAVNAMCQLNSIGAKIAKIKGVNALTDVTGFGLA
GHLLEVCQGAKLTAKLNLDAVPLLPRALDYLAQGCIPGGTHRNYDSYGEHLPTLTDHQKA
ILCDPQTSGGLLVAVSSEAEAELVALLNAHQIEPICIGSLETPTSTANVVLC