Protein Info for Shewana3_0159 in Shewanella sp. ANA-3

Annotation: general secretion pathway protein L (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 213 to 232 (20 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details PF05134: T2SSL" amino acids 5 to 235 (231 residues), 296.3 bits, see alignment E=1.4e-92 TIGR01709: type II secretion system protein L" amino acids 5 to 394 (390 residues), 418.1 bits, see alignment E=1.9e-129 PF12693: GspL_C" amino acids 239 to 394 (156 residues), 187.4 bits, see alignment E=1.6e-59

Best Hits

KEGG orthology group: K02461, general secretion pathway protein L (inferred from 100% identity to shm:Shewmr7_0159)

Predicted SEED Role

"General secretion pathway protein L"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRI4 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Shewana3_0159 general secretion pathway protein L (RefSeq) (Shewanella sp. ANA-3)
MSERLFIRLGRTAEQACSWLVWSEQEQEIIASGELANAQGLSTLTERAGNRPIDVLVPAS
AMTLTSVNLPEKGQRQALKALPFMLEETIADDVDAMHFTVGPRNGDALSVVAVAHEQMQT
WLSCLAEAGLKVKRIVPDCLALPLQECQWAAMRFGNELLLRTGLGTGHSLPLPWLPVAMK
QLTAQADEVSVASYTEMELDGVELKPQPLDLPMLVLARGILHAPINLLTGVYTPKREYSK
HLLQWKNAAIVLGVAIVLSLVNKGLTIHQVNGQIADLKAQSEAIYQQVVPGNSRIVNLRS
QMESQLRALQGQGSGAEFFAMLDGLQDAFKQVPELKPNTLRFESARNEIRMQVTAKNYAQ
IEKFKEIVGRRFQMDGGTMNSGEDQVTSTLTLRSK