Protein Info for Shewana3_0151 in Shewanella sp. ANA-3

Annotation: general secretion pathway protein D (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 702 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 33 to 621 (589 residues), 519.4 bits, see alignment E=6.2e-160 PF21305: type_II_gspD_N0" amino acids 34 to 103 (70 residues), 90.6 bits, see alignment E=7.1e-30 PF03958: Secretin_N" amino acids 130 to 191 (62 residues), 48.4 bits, see alignment 1.3e-16 amino acids 195 to 265 (71 residues), 54.1 bits, see alignment E=2.2e-18 amino acids 270 to 348 (79 residues), 58.8 bits, see alignment E=7.8e-20 PF00263: Secretin" amino acids 453 to 613 (161 residues), 170.8 bits, see alignment E=3.1e-54

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 100% identity to shn:Shewana3_0151)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRH6 at UniProt or InterPro

Protein Sequence (702 amino acids)

>Shewana3_0151 general secretion pathway protein D (RefSeq) (Shewanella sp. ANA-3)
MNNKRIRRKLIAGVVAGATMLTSQFVWSEQYAANFKGTDIQEFINIVGKNLNKTIIVDPT
IRGKINVRSYDLLNDEQYYQFFLNVLQVYGYAIVEMENNVIKVIKDKDAKTAAIRVANDN
DPGLGDEMVTRIVALYNTEAKQLAPLLRQLNDNAGGGNVVNYDPSNVLMLSGRAAVVNKL
VEIVRRVDKQGDTSVQVVPLEYASAGEMVRIIDTLYRATANQAQLPGQAPKVVADERINA
VVVSGDEKSRQRVVELIHRLDAEQASTGNTKVRYLRYAKAEDLVEVLTGFAQKLEGEKDP
SAQAGGKRRNEINIMAHTDTNALVISAEPDQMRTIESVINQLDIRRAQVLVEAIIVEVAE
GDNVGFGVQWAAKADGGTQFNNLGPTIGEIGAGIWQAQDKEGTYITNPSTGEVIGKNPDT
KGDVTLLAQALGKVNGMAWGVAMGDFGALVQAVSADTNSNVLATPSITTLDNQEASFIVG
DEVPILTGSTASSNNSNPFQTVERKEVGVKLKVVPQINEGNAVKLAIEQEVSGVNGNTGV
DISFATRRLTTTVMADSGQIVVLGGLINEEVQESVQKVPFLGDIPVLGHLFKSSSSKKTK
KNLMIFIKPTIIRDGVTMEGIAGRKYNYFRALQLEQQERGVNLMPNTQVPILEEWNQSEY
LPPEVNDILDRYKEGKGLETQMRKTDSTLKSLDENKNKDKTQ