Protein Info for Shewana3_0150 in Shewanella sp. ANA-3

Annotation: general secretion pathway protein C (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details PF11356: T2SSC" amino acids 28 to 167 (140 residues), 143.9 bits, see alignment E=1.6e-46 TIGR01713: type II secretion system protein C" amino acids 28 to 303 (276 residues), 193.5 bits, see alignment E=2.5e-61

Best Hits

KEGG orthology group: K02452, general secretion pathway protein C (inferred from 100% identity to shn:Shewana3_0150)

Predicted SEED Role

"General secretion pathway protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRH5 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Shewana3_0150 general secretion pathway protein C (RefSeq) (Shewanella sp. ANA-3)
MDLLDKVIAKAAGIPHKPLSQVVFWFGFILSLLLAAQITWKLVPSTSSPTAWSPTAVTTT
GKGAGQVDLAGLQQLALFGRADAKSDKPKVEVVETVTDAPKTSLSIQLTGVVASTADQKG
LAIIESSGSQETYSLGDKIKGTSASLKEVYADRIIITNAGRYETLMLDGLVYTSQSPANQ
QLQKAKSEKAEVVSRVDQRKNTEISQELAESRSELLADPSKITDYIAISPVRQGESVVGY
RLNPGKDVNLFKQAGFKPNDLAKSINGYDLTVMSQALEMMSQLPELTEVSIMVEREGQLV
EIMFSLPQ