Protein Info for Shewana3_0149 in Shewanella sp. ANA-3

Annotation: RNA-binding S4 domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF01479: S4" amino acids 11 to 53 (43 residues), 40.4 bits, see alignment E=2e-14 PF28601: HSP15_C" amino acids 91 to 131 (41 residues), 56.8 bits, see alignment E=1.7e-19

Best Hits

Swiss-Prot: 62% identical to HSLR_ECOLI: Heat shock protein 15 (hslR) from Escherichia coli (strain K12)

KEGG orthology group: K04762, ribosome-associated heat shock protein Hsp15 (inferred from 100% identity to shn:Shewana3_0149)

Predicted SEED Role

"Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog)" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRH4 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Shewana3_0149 RNA-binding S4 domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MTQSSGDSGSVRLDKWLWAARFYKTRAIAKEMINGGKVHYNGARTKSSKNAEIGAVLKIR
QGYDDKEIVIKKLSEMRQSATIAQELYEETAASVAKRAVNAEARRLNILNNPAPDHKPDK
KQRRQLIRFKEC