Protein Info for Shewana3_0142 in Shewanella sp. ANA-3

Annotation: sodium:dicarboxylate symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 179 to 204 (26 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 263 to 279 (17 residues), see Phobius details amino acids 295 to 319 (25 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details PF00375: SDF" amino acids 12 to 401 (390 residues), 379.8 bits, see alignment E=8.1e-118

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0142)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRG7 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Shewana3_0142 sodium:dicarboxylate symporter (RefSeq) (Shewanella sp. ANA-3)
MKSKSLLGNIGVQVVIAMIIGALVGFTMGESASIFAPLGTIFIHLVKMLVIPLVLVSIIS
GAASLGDSPSAGKIGVGTFGFFIVTSGIAVALALVMGNMFTPGAGVDFTAHSSSGLMEVT
AEHGALPGVMDTFIGMIPTNVFESLTGGNILQILVFSIFFGIALTKVKGDGAKPIMAALN
TVVDAFVWMINCVMVIAPIGVFGLMADSVGTFGFDALEVVFKLFAVFVAAILIYGFVFFP
LVVQLFSRVSARQFISAMKKPQVMALSTASSMATLPVNMETCEEDLKVSKATTAFVLPLG
ATINMSGNAIYYGLVAMFFAQMYNVDLSMTAYAAIIFTSTLGAIGQAGVPGPSFLVVAVL
LAAGIPIDGLPLLFALDRVFDMIRTALNITGDAACAVIMDKYTAEPSSN