Protein Info for Shewana3_0117 in Shewanella sp. ANA-3

Annotation: MscS mechanosensitive ion channel (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 173 to 200 (28 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 191 to 259 (69 residues), 58.2 bits, see alignment E=7.2e-20 PF21082: MS_channel_3rd" amino acids 337 to 401 (65 residues), 28.3 bits, see alignment E=1.9e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0117)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRE2 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Shewana3_0117 MscS mechanosensitive ion channel (RefSeq) (Shewanella sp. ANA-3)
MDQEIRLEISGWLSSVGIDSQPSDSISTSIMLLACVLVAAIAYFIMRRGVIRAVNMVILR
SKATWDDVFMRYKVLEKLAMLVPAIVLNLLVPITLTEHPVLSSLVDRLLSIWLVILMIRA
IYAGLDAVNEISDVNLVSRRLPVKSFVQLIKLFLFFVGLIVSISVLADQSPVYFLSGLGV
ATGFVMLVFRDTILGFVAGIQLAANRMVSKGDWIQMDKYGADGAVEEVSLTTVKVRNWDK
TITMIPAYALVSDAFRNWRGMSESGGRRIKRAVNIDINSIKFLSEEERNRLSKINCLKEY
FPAKISEIQESNAKVSDLDMKVNGRHLTNVGTFRAYLQEYLQRHDKVHKDMTLMVRQLAP
TTEGLPIEIYIFTNDTRWAFYEAIQADIFDHIFAVLPEFGLQAFQAPTGNDIRSLKSVKV
EG