Protein Info for Shewana3_0105 in Shewanella sp. ANA-3

Annotation: formate dehydrogenase accessory protein FdhE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 147 to 168 (22 residues), see Phobius details PF04216: FdhE_N" amino acids 20 to 173 (154 residues), 135.7 bits, see alignment E=2.9e-43 TIGR01562: formate dehydrogenase accessory protein FdhE" amino acids 26 to 296 (271 residues), 214 bits, see alignment E=1.9e-67 PF24859: FdhE_central" amino acids 181 to 218 (38 residues), 63.2 bits, see alignment 2.8e-21 PF24860: FdhE_C" amino acids 220 to 295 (76 residues), 69 bits, see alignment E=5.2e-23

Best Hits

Swiss-Prot: 100% identical to FDHE_SHESR: Protein FdhE homolog (fdhE) from Shewanella sp. (strain MR-7)

KEGG orthology group: K02380, FdhE protein (inferred from 100% identity to shn:Shewana3_0105)

Predicted SEED Role

"formate dehydrogenase formation protein FdhE" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRD0 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Shewana3_0105 formate dehydrogenase accessory protein FdhE (RefSeq) (Shewanella sp. ANA-3)
MSHTAEIPMVPGSESPLELKPLKAVDPKTVYHRRAQRLLSLAKDSPLADYFELCRRVVAI
QARLAAEADFGQLLAWGKDEAIPLSHLGSEADSYWQGLLQQLLSDLLPQVDEDMARVLRL
LMQQSPEQLTSWGSALRQGHMSEVPARFSLFIWAAMGVYWSHWAPMVIKRIDQRKVVQQN
LCPICGCHPVASVIVDQPRAGLRYLHCSLCESEWHYIRAHCTSCGQDKGTTLWSFDDAKA
QVRIESCDECHGYTKMLFVEKSPLMDVAADDLATLMLDSELNAKGFGATTVNPLLLAHET
EQ