Protein Info for Shewana3_0062 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 34 to 56 (23 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details PF01925: TauE" amino acids 13 to 240 (228 residues), 114.1 bits, see alignment E=4.2e-37

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 99% identity to she:Shewmr4_0060)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR88 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Shewana3_0062 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MLTDPVFWLVAIPAVLITGISKSGFAGGVGGLTVPLLALAISPATAAAIMLPLLIYMDFL
SVRSWWGQHNPRQLWILLPAAIVGIGIAYWLFDRLNEDYLRAILGCVSLGFGLYGLILGD
KTQATPSPLVGRLCGLTAGFTSFVAHAGGPPLNAYLLPLRLAKPEFLATAVVFFAVVNLV
KLVPYSLLGQINQGNILISLLLAPLAWLGVKLGLAIQDKISDRLFKRIILILMVLVGIRL
LWTAL