Protein Info for Shewana3_0057 in Shewanella sp. ANA-3

Annotation: TrkH family potassium uptake protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 305 to 338 (34 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 414 to 436 (23 residues), see Phobius details PF02386: TrkH" amino acids 31 to 430 (400 residues), 185 bits, see alignment E=1.1e-58 TIGR00933: potassium uptake protein, TrkH family" amino acids 42 to 425 (384 residues), 351.7 bits, see alignment E=2.9e-109

Best Hits

Swiss-Prot: 47% identical to KTRB_BACSU: Ktr system potassium uptake protein B (ktrB) from Bacillus subtilis (strain 168)

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 100% identity to shn:Shewana3_0057)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR83 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Shewana3_0057 TrkH family potassium uptake protein (RefSeq) (Shewanella sp. ANA-3)
MVQWHPSLTLEHTPKSGKKLFGAPPFILSVSFALLILIGTCLLKLPIATESPITWLQSLF
TVTSAVTVTGLVVVDTGSVFTPFGQVIIALLIQCGGLGLMTFAIVTLIALGGKIGFLQQT
VAKEAFNQTDTSTLVSTAKAVLMFSLLVEAVGMLILSVYWSGELGWQTSLFHGFFYTISA
FNNAGFALSPDSLIPYVADPVVNLTITGLFIVGGLGFSVWIDLKRNKRWAKLTVYSRMMI
TGTILINAVAVIAIYLIEYNNPNTLAPLSELGKWLASWFQAVTPRTAGFNTLPIDQLEDG
STLLILVLMFIGGGSLSTASGIKVVTFMVLILATYGYLRRDEAVYVFKREIPKDTISKAL
ALTMISIGVTWLAIFALVLTEKAPIMDIAFEAVSALGTVGLSRGLTGNLSSAGQGIIIFM
MFMGRLGPLMLAYFLANPRVKKLRYAETKLAIG