Protein Info for Shewana3_0035 in Shewanella sp. ANA-3

Name: def
Annotation: peptide deformylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 TIGR00079: peptide deformylase" amino acids 4 to 160 (157 residues), 201.6 bits, see alignment E=2.9e-64 PF01327: Pep_deformylase" amino acids 4 to 152 (149 residues), 183.4 bits, see alignment E=1.1e-58

Best Hits

Swiss-Prot: 97% identical to DEF1_SHEON: Peptide deformylase 1 (def1) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01462, peptide deformylase [EC: 3.5.1.88] (inferred from 100% identity to shn:Shewana3_0035)

MetaCyc: 61% identical to peptide deformylase (Escherichia coli K-12 substr. MG1655)
Peptide deformylase. [EC: 3.5.1.88]

Predicted SEED Role

"Peptide deformylase (EC 3.5.1.88)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase (EC 3.5.1.88)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.88

Use Curated BLAST to search for 3.5.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR61 at UniProt or InterPro

Protein Sequence (168 amino acids)

>Shewana3_0035 peptide deformylase (RefSeq) (Shewanella sp. ANA-3)
MALLKVLRFPDERLRTQATPVTEFTAELQTQIDDMFETMYQEKGIGLAATQVDYHKQLIV
MDLQDEVDRPKVFINPEIIASSGDFCNEEGCLSVPGIYAKVDRAEFVTVKALDRHGNEFT
VEADELFAICIQHEMDHLKGKLFVDYLSPLKRQRIKQKLEKAARQDAK