Protein Info for Shewana3_0021 in Shewanella sp. ANA-3

Annotation: sulfur transfer protein SirA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 81 PF01206: TusA" amino acids 11 to 79 (69 residues), 80.1 bits, see alignment E=4.4e-27

Best Hits

Swiss-Prot: 100% identical to TUSA_SHESA: Sulfur carrier protein TusA (tusA) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K04085, tRNA 2-thiouridine synthesizing protein A [EC: 2.8.1.-] (inferred from 98% identity to son:SO_0019)

MetaCyc: 76% identical to sulfur transfer protein TusA (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusA"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR47 at UniProt or InterPro

Protein Sequence (81 amino acids)

>Shewana3_0021 sulfur transfer protein SirA (RefSeq) (Shewanella sp. ANA-3)
MNDVFSTAQHKLDALGLRCPEPVMMVRKTVRQMAQGETLLIIADDPATTRDIPSFCEFMD
HTLVASETSQTPYQYLIKKGL