Protein Info for Shewana3_0007 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 84 PF01809: YidD" amino acids 10 to 75 (66 residues), 105 bits, see alignment E=6.8e-35 TIGR00278: putative membrane protein insertion efficiency factor" amino acids 13 to 81 (69 residues), 112.9 bits, see alignment E=2.4e-37

Best Hits

Swiss-Prot: 100% identical to YIDD_SHESR: Putative membrane protein insertion efficiency factor (Shewmr7_4033) from Shewanella sp. (strain MR-7)

KEGG orthology group: K08998, hypothetical protein (inferred from 96% identity to sbn:Sbal195_4522)

Predicted SEED Role

"Protein YidD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR33 at UniProt or InterPro

Protein Sequence (84 amino acids)

>Shewana3_0007 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MAQTQSPLQWLATTFIRGYQIFISPLLGPRCRFNPTCSHYAIEAIKVHGTAKGCWFALKR
ILKCHPLHPGGSDPVPPKNDRCNK