Protein Info for Shewana3_4387 in Shewanella sp. ANA-3

Annotation: peptidase M56, BlaR1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details PF05569: Peptidase_M56" amino acids 100 to 208 (109 residues), 32.4 bits, see alignment E=5.7e-12 PF01435: Peptidase_M48" amino acids 148 to 211 (64 residues), 33.8 bits, see alignment E=3.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_4387)

Predicted SEED Role

"Regulatory sensor-transducer, BlaR1/MecR1 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L3G9 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Shewana3_4387 peptidase M56, BlaR1 (RefSeq) (Shewanella sp. ANA-3)
MFVGDLAIALNLLSVAVLAFAISVACISIALRLTLPRFEHLTFRLRKVILWALVTVPWWV
AISCAAFFWPRQQELFSTAWLNEFAHWHHVDIFSFSSWHAFTLLSAFGYLIWSMISTIYV
RKKQSSTMASLIGLSEIQPQVTITQQRYYSLAQAIPAAFTTGLVSPKIYLTTGLQEKVTE
QQLDIIVRHEMAHVVARDPLFKVIFAAFAGFYPKAAKRNLIGHFTLLTEQLADHAVTTEH
DNLDVAQALINVARMQRSVTLGCDGLQTSYFGNDQTSVRVQRLIQPRLTSSRLAIGLTLL
FLAIVPLLTASTVDSLHHIIETFFTH