Protein Info for Shewana3_4385 in Shewanella sp. ANA-3

Annotation: secretion protein HlyD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 188 to 222 (35 residues), 28.1 bits, see alignment 2.7e-10 PF00364: Biotin_lipoyl" amino acids 198 to 247 (50 residues), 22.8 bits, see alignment 1.3e-08 PF16576: HlyD_D23" amino acids 227 to 328 (102 residues), 32.4 bits, see alignment E=1.2e-11 PF13437: HlyD_3" amino acids 229 to 319 (91 residues), 38.5 bits, see alignment E=3.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_4385)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L3G7 at UniProt or InterPro

Protein Sequence (414 amino acids)

>Shewana3_4385 secretion protein HlyD (RefSeq) (Shewanella sp. ANA-3)
MKNNNTFSSLSLAILLSLGINAVASTPLMASSAPVAEQAEPEKGPHRGRMLREGDFALEL
AIFETGVPPEFRVWTSFEGKPLDPKTVDLSVKLTRLGNVVDDIRFNAQGDFLRGDMEIYE
PHSFIVTIEAKYQGKTYRWQYDNFEGRTTIEQAVASAMEIHSGFAGPATLHQTIPAYGTL
ALPVGTQRAIAARFDGEITRLHVGLGDRVKKGQTLLTVESNESLKPYQIKAPSDGVVSAL
FANNGEQTLGRQLLTLTDNSHYIAKLAVYPIDYQSVILGAPVTINVEGVEETYQGSISFI
EPEVRDDQARIAWVKLADPNGVLTAGSFVNASIEVATIEVPLAVKRVGLQGFRDFTVVFA
KVGEQYEVRMLELGRQDGEWVEVLGGLKPGTEYVTDNSYILKADIEKSGASHDH