Protein Info for Shewana3_4349 in Shewanella sp. ANA-3

Annotation: umuC protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF11799: IMS_C" amino acids 47 to 161 (115 residues), 57.1 bits, see alignment E=2.3e-19 PF13438: DUF4113" amino acids 170 to 218 (49 residues), 84.1 bits, see alignment 5.5e-28

Best Hits

KEGG orthology group: K03502, DNA polymerase V (inferred from 100% identity to shn:Shewana3_4349)

Predicted SEED Role

"Error-prone, lesion bypass DNA polymerase V (UmuC)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L3D1 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Shewana3_4349 umuC protein (RefSeq) (Shewanella sp. ANA-3)
MNIKTAYDLAQMPAGHARKQFSIEIERTVRELNGIECKQWDQARADKQQIFSTRSVGERI
TDFNSLLQALSKHVGIAAAKARAQGSSCKSMLLFASNSPFDDQPKSFKTLIHFPCATNST
VEMTQAVSAAAPKLFREGVRYYKIGVGLINLVCDKRQQFDLFNAPKANPALMQALDGINF
RYGRDTLFLAAQGIEQKWAMRRELLSPQYTTKWDCLPMIKC